PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi09g09360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family YABBY
Protein Properties Length: 165aa    MW: 18237.5 Da    PI: 7.1963
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi09g09360.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY30.21.5e-091245235
            YABBY  2 dvfssseqvCyvqCnfCntilavsvPstslfkvv 35
                     ++ s s+q+Cyv+CnfC+t+la ++ ++ + ++v
  Vradi09g09360.1 12 QHLSPSDQLCYVHCNFCDTVLAEEIRNAPSANMV 45
                     67899*****************988877766666 PP

2YABBY136.72.8e-4260128102170
            YABBY 102 senedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                       +   ee+p++p ++rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  Vradi09g09360.1  60 MRGGPEETPKPPSANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 128
                      35567899***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.3E-61645IPR006780YABBY protein
PfamPF046908.0E-3964128IPR006780YABBY protein
SuperFamilySSF470951.96E-869122IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.2E-477120IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0009933Biological Processmeristem structural organization
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010093Biological Processspecification of floral organ identity
GO:0010154Biological Processfruit development
GO:0010158Biological Processabaxial cell fate specification
GO:0010159Biological Processspecification of organ position
GO:0010450Biological Processinflorescence meristem growth
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MSSSSTSFSP DQHLSPSDQL CYVHCNFCDT VLAEEIRNAP SANMVMNQMP NPNDLVTSTM  60
RGGPEETPKP PSANRPPEKR QRVPSAYNRF IKDEIQRIKA GNPDISHREA FSAAAKNWAH  120
FPHIHFGLMP DHQPVKKANV RQEAEDVLIK DGFFAPANVG VSPF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00620PBMTransfer from AT2G45190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0983011e-156BT098301.1 Soybean clone JCVI-FLGm-12E18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515810.11e-104PREDICTED: axial regulator YABBY 1
SwissprotO221523e-57YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A0L9VRS11e-104A0A0L9VRS1_PHAAN; Uncharacterized protein
STRINGGLYMA01G33370.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20403490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.15e-61YABBY family protein